RHBDD1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14350T
Article Name: RHBDD1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14350T
Supplier Catalog Number: CNA14350T
Alternative Catalog Number: MBL-CNA14350T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 206-315 of human RHBDD1 (NP_115652.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 84236
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: TQGPLKKIMEACAGGFSSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFDSQ
Target: RHBDD1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100