ATP6V1G3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14443T
Article Name: ATP6V1G3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14443T
Supplier Catalog Number: CNA14443T
Alternative Catalog Number: MBL-CNA14443T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human ATP6V1G3 (NP_573569.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 127124
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
Target: ATP6V1G3
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100