RNASE3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA14489T
| Article Name: |
RNASE3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA14489T |
| Supplier Catalog Number: |
CNA14489T |
| Alternative Catalog Number: |
MBL-CNA14489T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RNASE3 (NP_002926.2). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
18kDa |
| NCBI: |
6037 |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
FLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYP |
| Target: |
RNASE3 |
| Application Dilute: |
WB: WB,1:500 - 1:1000 |
