POMGNT2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14518T
Article Name: POMGNT2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14518T
Supplier Catalog Number: CNA14518T
Alternative Catalog Number: MBL-CNA14518T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-340 of human POMGNT2 (NP_116195.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 84892
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: NPDNLMHVFHDDLLPLFYTLRQFPGLAHEARLFFMEGWGEGAHFDLYKLLSPKQPLLRAQLKTLGRLLCFSHAFVGLSKITTWYQYGFVQPQGPKANILVSGNEIRQFARFMTEKLNVSHTGVPLGEEYILVFSRTQNRLILNEAELLLALAQEFQMKTVTVSLEDHTFADVVRLVSNASM
Target: POMGNT2
Application Dilute: WB: WB,1:500 - 1:2000