CALM3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14526T
Article Name: CALM3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14526T
Supplier Catalog Number: CNA14526T
Alternative Catalog Number: MBL-CNA14526T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-149 of human CALM3 (NP_005175.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 808
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Target: CALM3
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200