[KO Validated] Glutathione Synthetase (GSS) Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: [KO Validated] Glutathione Synthetase (GSS) Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA14535T
• Supplier Catalog Number: CNA14535T
• Alternative Catalog Number: MBL-CNA14535T
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IF, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 373-474 of human Glutathione Synthetase (Glutathione Synthetase (GSS)) (NP_000169.1).
• Conjugation: Unconjugated

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 52kDa
• NCBI: 2937
• Buffer: PBS with 0.01% thimerosal,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.01% thimerosal,50% glycerol
• Sequence: NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV
• Target: GSS

Application Notes

• Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200