TOMM22 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14548T
Article Name: TOMM22 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14548T
Supplier Catalog Number: CNA14548T
Alternative Catalog Number: MBL-CNA14548T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human TOMM22 (NP_064628.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 56993
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRA
Target: TOMM22
Application Dilute: WB: WB,1:500 - 1:2000