Hemoglobin subunit alpha (HBA1) Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Hemoglobin subunit alpha (HBA1) Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA14551T
• Supplier Catalog Number: CNA14551T
• Alternative Catalog Number: MBL-CNA14551T
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Hemoglobin subunit alpha (Hemoglobin subunit alpha (HBA1)) (NP_000549.1).
• Conjugation: Unconjugated

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 15kDa
• NCBI: 3039
• Buffer: PBS with 0.01% thimerosal,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.01% thimerosal,50% glycerol
• Sequence: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFK
• Target: HBA1

Application Notes

• Application Dilute: WB: WB,1:500 - 1:2000