SAA1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14553T
Article Name: SAA1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14553T
Supplier Catalog Number: CNA14553T
Alternative Catalog Number: MBL-CNA14553T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SAA1 (NP_000322.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 6288
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISDARENIQRFFGHGAEDSLADQAA
Target: SAA1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200