RPS27A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14618S
Article Name: RPS27A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14618S
Supplier Catalog Number: CNA14618S
Alternative Catalog Number: MBL-CNA14618S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-156 of human RPS27A (NP_001170884.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 18kDa
NCBI: 6233
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
Target: RPS27A
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200