MYH13 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14620T
Article Name: MYH13 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14620T
Supplier Catalog Number: CNA14620T
Alternative Catalog Number: MBL-CNA14620T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1240-1320 of human MYH13 (NP_003793.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 224kDa
NCBI: 8735
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: EALSKSKSNIERTCRTVEDQFSEIKAKDEQQTQLIHDLNMQKARLQTQNGELSHRVEEKESLISQLTKSKQALTQQLEELK
Target: MYH13
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100