Dopamine Receptor D3 (DRD3) Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA14622T
| Article Name: |
Dopamine Receptor D3 (DRD3) Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA14622T |
| Supplier Catalog Number: |
CNA14622T |
| Alternative Catalog Number: |
MBL-CNA14622T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dopamine Receptor D3 (Dopamine Receptor D3 (DRD3)) (NP_000787.2). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
44kDa |
| NCBI: |
1814 |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
MASLSQLSGHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSR |
| Target: |
DRD3 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
