RAB1A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14663T
Article Name: RAB1A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14663T
Supplier Catalog Number: CNA14663T
Alternative Catalog Number: MBL-CNA14663T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB1A (NP_004152.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 5861
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFN
Target: RAB1A
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200