CD209 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1466S
Article Name: CD209 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1466S
Supplier Catalog Number: CNA1466S
Alternative Catalog Number: MBL-CNA1466S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 265-404 of human CD209 (NP_066978.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 30835
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: GNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA
Target: CD209
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200