BMP2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14708S
Article Name: BMP2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14708S
Supplier Catalog Number: CNA14708S
Alternative Catalog Number: MBL-CNA14708S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BMP2 (NP_001191.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 650
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLE
Target: BMP2
Application Dilute: WB: WB,1:500 - 1:1000