CACNB3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14710T
Article Name: CACNB3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14710T
Supplier Catalog Number: CNA14710T
Alternative Catalog Number: MBL-CNA14710T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 355-484 of human CACNB3 (NP_000716.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 784
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: VYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY
Target: CACNB3
Application Dilute: WB: WB,1:500 - 1:2000