CD36/SR-B3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14714T
Article Name: CD36/SR-B3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14714T
Supplier Catalog Number: CNA14714T
Alternative Catalog Number: MBL-CNA14714T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CD36/SR-B3 (NP_000063.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 948
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: AFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQ
Target: CD36
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200