ADRA1A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1471S
Article Name: ADRA1A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1471S
Supplier Catalog Number: CNA1471S
Alternative Catalog Number: MBL-CNA1471S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 346-475 of human ADRA1A (NP_150646.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 148
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LCRKQSSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCTTARTKSRSVTRLECSGMILAHCNLRLPGSRDSPASASQAAGTTGMCHQADATRPS
Target: ADRA1A
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:200