EPHB6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14728T
Article Name: EPHB6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14728T
Supplier Catalog Number: CNA14728T
Alternative Catalog Number: MBL-CNA14728T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 615-729 of human EPHB6 (NP_001267724.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 111kDa
NCBI: 2051
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: HFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV
Target: EPHB6
Application Dilute: WB: WB,1:500 - 1:2000