PCDH9 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14760T
Article Name: PCDH9 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14760T
Supplier Catalog Number: CNA14760T
Alternative Catalog Number: MBL-CNA14760T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 400-600 of human PCDH9 (NP_982354.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 136kDa
NCBI: 5101
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDAD
Target: PCDH9
Application Dilute: WB: WB,1:500 - 1:2000