S100A5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14779T
Article Name: S100A5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14779T
Supplier Catalog Number: CNA14779T
Alternative Catalog Number: MBL-CNA14779T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100A5 (NP_002953.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 11kDa
NCBI: 6276
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK
Target: S100A5
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200