S100P Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14780T
Article Name: S100P Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14780T
Supplier Catalog Number: CNA14780T
Alternative Catalog Number: MBL-CNA14780T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-95 of human S100P (NP_005971.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 10kDa
NCBI: 6286
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Target: S100P
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000