BAG3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14826T
Article Name: BAG3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14826T
Supplier Catalog Number: CNA14826T
Alternative Catalog Number: MBL-CNA14826T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 380-575 of human BAG3 (NP_004272.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 9531
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHPGVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP
Target: BAG3
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IP,1:50 - 1:100