EMC8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14838T
Article Name: EMC8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14838T
Supplier Catalog Number: CNA14838T
Alternative Catalog Number: MBL-CNA14838T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human EMC8 (NP_006058.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 10328
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC
Target: EMC8
Application Dilute: WB: WB,1:500 - 1:2000