CDKN1A/p21CIP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1483S1
Article Name: CDKN1A/p21CIP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1483S1
Supplier Catalog Number: CNA1483S1
Alternative Catalog Number: MBL-CNA1483S1
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-164 of human CDKN1A/p21CIP1 (NP_000380.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 18kDa
NCBI: 1026
Buffer: PBS with 0.09% Sodium azide,50% glycerol
Source: Rabbit
Sequence: ALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
Target: CDKN1A
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200