ATRNL1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14868T
Article Name: ATRNL1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14868T
Supplier Catalog Number: CNA14868T
Alternative Catalog Number: MBL-CNA14868T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 53-160 of human ATRNL1 (NP_001263211.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 153kDa
NCBI: 26033
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LYAQVSQSKPCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLI
Target: ATRNL1
Application Dilute: WB: WB,1:500 - 1:2000