HTRA2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14877S
Article Name: HTRA2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14877S
Supplier Catalog Number: CNA14877S
Alternative Catalog Number: MBL-CNA14877S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 334-458 of human HTRA2 (NP_037379.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 27429
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
Target: HTRA2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:50 - 1:100