ZNF259 Rabbit mAb, Clone: [ARC2563], Unconjugated, Monoclonal

Catalog Number: MBL-CNA1487S
Article Name: ZNF259 Rabbit mAb, Clone: [ARC2563], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA1487S
Supplier Catalog Number: CNA1487S
Alternative Catalog Number: MBL-CNA1487S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 360-459 of human ZNF259 (O75312).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2563]
Molecular Weight: 51kDa
NCBI: 8882
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: DIRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR
Target: ZPR1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200