LGALSL Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14880T
Article Name: LGALSL Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14880T
Supplier Catalog Number: CNA14880T
Alternative Catalog Number: MBL-CNA14880T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human LGALSL (NP_054900.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 29094
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG
Target: LGALSL
Application Dilute: WB: WB,1:500 - 1:2000