CDK12 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14894P
Article Name: CDK12 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14894P
Supplier Catalog Number: CNA14894P
Alternative Catalog Number: MBL-CNA14894P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human CDK12 (NP_057591.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 164kDa
NCBI: 51755
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MPNSERHGGKKDGSGGASGTLQPSSGGGSSNSRERHRLVSKHKRHKSKHSKDMGLVTPEAASLGTVIKPLVEYDDISSDSDTFSDDMAFKLDRRENDERRGSDRSDRLHKHRHHQHRRSRDLLKAKQTEKEKSQEVSSKSGSMKDRISGSSKRSNEETDDYGKAQVAKSSSKESRSSKLHKEKTRKERELKSGHKDRSKSHRKRETPKSYKTVDSPKRRSRSPHRKWSDSSKQDDSPSGASYGQDYDLSPSRSH
Target: CDK12
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:100 - 1:500