POT1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1491S
Article Name: POT1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1491S
Supplier Catalog Number: CNA1491S
Alternative Catalog Number: MBL-CNA1491S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 497-634 of human POT1 (NP_056265.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 25913
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: TIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSSVAEALGIVPLQYVFVMTFTLDDGTGVLEAYLMDSDKFFQIPASEVLMDDDLQKSVDMIMDMFCPPGIKIDAYPWLECFIKSYNVTNGTDNQICYQIFDTTVAEDVI
Target: POT1
Application Dilute: WB: WB,1:200 - 1:2000