OXCT2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14920T
Article Name: OXCT2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14920T
Supplier Catalog Number: CNA14920T
Alternative Catalog Number: MBL-CNA14920T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 430-510 of human OXCT2 (NP_071403.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 64064
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: QKTRVVVTMQHCTKDNTPKIMEKCTMPLTGKRCVDRIITEKAVFDVHRKKELTLRELWEGLTVDDIKKSTGCAFAVSPNLR
Target: OXCT2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200