RMND5A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14924T
Article Name: RMND5A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14924T
Supplier Catalog Number: CNA14924T
Alternative Catalog Number: MBL-CNA14924T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-270 of human RMND5A (NP_073617.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 64795
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ISLLMGGTTNQREALQYAKNFQPFALNHQKDIQVLMGSLVYLRQGIENSPYVHLLDANQWADICDIFTRDA
Target: RMND5A
Application Dilute: WB: WB,1:500 - 1:2000