RASSF4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14943T
Article Name: RASSF4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14943T
Supplier Catalog Number: CNA14943T
Alternative Catalog Number: MBL-CNA14943T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human RASSF4 (NP_114412.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 83937
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MKEDCLPSSHVPISDSKSIQKSELLGLLKTYNCYHEGKSFQLRHREEEGTLIIEGLLNIAWGLRRPIRLQMQDDREQVHLPSTSWMPRRPSCPLKEPSPQNGNITAQGPSIQPVHKAESSTDSSGPLEEAEEAPQLMRTKSDASCMSQRRPKCRAPGEAQ
Target: RASSF4
Application Dilute: WB: WB,1:500 - 1:2000