MRPL54 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14957T
Article Name: MRPL54 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14957T
Supplier Catalog Number: CNA14957T
Alternative Catalog Number: MBL-CNA14957T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-138 of human MRPL54 (NP_758455.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 116541
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL
Target: MRPL54
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200