OCIAD2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14962T
Article Name: OCIAD2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14962T
Supplier Catalog Number: CNA14962T
Alternative Catalog Number: MBL-CNA14962T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-99 of human OCIAD2 (NP_689611.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 132299
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MASASARGNQDKDAHFPPPSKQSLLFCPKSKLHIHRAEISKIMRECQEESFWKRALPFSLVSMLVTQGLVYQGYLAANSRFGSLPKVARTASLPVRNAK
Target: OCIAD2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200