SLCO6A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14963T
Article Name: SLCO6A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14963T
Supplier Catalog Number: CNA14963T
Alternative Catalog Number: MBL-CNA14963T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 480-580 of human SLCO6A1 (NP_775759.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 79kDa
NCBI: 133482
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: VQFAGINEDYDGTGKLGNLTAPCNEKCRCSSSIYSSICGRDDIEYFSPCFAGCTYSKAQNQKKMYYNCSCIKEGLITADAEGDFIDARPGKCDAKCYKLPL
Target: SLCO6A1
Application Dilute: WB: WB,1:500 - 1:2000