STAT2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA14995P
Article Name: STAT2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA14995P
Supplier Catalog Number: CNA14995P
Alternative Catalog Number: MBL-CNA14995P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 550-706 of human STAT2 (NP_005410.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 98kDa
NCBI: 6773
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: KLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLLRFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDEL
Target: STAT2
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200