AARS Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15017T
Article Name: AARS Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15017T
Supplier Catalog Number: CNA15017T
Alternative Catalog Number: MBL-CNA15017T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AARS (NP_001596.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 107kDa
NCBI: 16
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEM
Target: AARS1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200