ADK Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15024T
Article Name: ADK Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15024T
Supplier Catalog Number: CNA15024T
Alternative Catalog Number: MBL-CNA15024T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-345 of human ADK (NP_001114.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 132
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDFH
Target: ADK
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:500|IF/ICC,1:50 - 1:200