Calbindin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15035T
Article Name: Calbindin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15035T
Supplier Catalog Number: CNA15035T
Alternative Catalog Number: MBL-CNA15035T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-261 of human Calbindin (NP_004920.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 793
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLAL
Target: CALB1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100