FOXN3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15039T
Article Name: FOXN3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15039T
Supplier Catalog Number: CNA15039T
Alternative Catalog Number: MBL-CNA15039T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 269-468 of human FOXN3 (NP_005188.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 1112
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: VRPLPITPIGVTAAMRNGITSCRMRTESEPSCGSPVVSGDPKEDHNYSSAKSSNARSTSPTSDSISSSSSSADDHYEFATKGSQEGSEGSEGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLLHLAGIRSCLNNITNRTAKGQKEQKETTKN
Target: FOXN3
Application Dilute: WB: WB,1:500 - 1:2000