PKNOX1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15301T
Article Name: PKNOX1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15301T
Supplier Catalog Number: CNA15301T
Alternative Catalog Number: MBL-CNA15301T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 322-436 of human PKNOX1 (NP_004562.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 5316
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LDSSCSETPKTKKKTAQNRPVQRFWPDSIASGVAQPPPSELTMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEEDAGALAPAHISGLVLENSDSLQ
Target: PKNOX1
Application Dilute: WB: WB,1:200 - 1:2000