PSMG1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15339T
Article Name: PSMG1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15339T
Supplier Catalog Number: CNA15339T
Alternative Catalog Number: MBL-CNA15339T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-288 of human PSMG1 (NP_003711.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 8624
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARKREVRLLRRQTKTSLEVSLLEKYPCSKFIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPIL
Target: PSMG1
Application Dilute: WB: WB,1:200 - 1:2000|IHC-P,1:50 - 1:200