TRK fused gene (TFG) Rabbit mAb, Clone: [ARC1882], Unconjugated, Monoclonal

Catalog Number: MBL-CNA1534S
Article Name: TRK fused gene (TFG) Rabbit mAb, Clone: [ARC1882], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA1534S
Supplier Catalog Number: CNA1534S
Alternative Catalog Number: MBL-CNA1534S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 301-400 of human TRK fused gene (TFG) (Q92734).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1882]
Molecular Weight: 43kDa
NCBI: 10342
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: APAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR
Target: TFG
Application Dilute: WB: WB,1:500 - 1:2000