FCHSD1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15543T
Article Name: FCHSD1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15543T
Supplier Catalog Number: CNA15543T
Alternative Catalog Number: MBL-CNA15543T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-400 of human FCHSD1 (NP_258260.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 77kDa
NCBI: 89848
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RLQASDRYRDLAGGTGRSAKEQVLRKGTENLQRAQAEVLQSVRELSRSRKLYGQRERVWALAQEKAADVQARLNRSDHGIFHSRTSLQKLSTKLSAQSAQYSQQLQAARNEYLLNLVATNAHLDHYYQEELPALLKALVSELSEHLRDPLTSLSHTELEAAEVILEHAHRGEQTTSQVSWEQDLKLFLQEPGVFSPTPPQQFQPAGTDQVCVLEWGAEGVAGKSGLEKEVQRLTSRAARDYKIQNHGHRVLQRL
Target: FCHSD1
Application Dilute: WB: WB,1:200 - 1:2000|IHC-P,1:50 - 1:200