TPD52L3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15545T
Article Name: TPD52L3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15545T
Supplier Catalog Number: CNA15545T
Alternative Catalog Number: MBL-CNA15545T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human TPD52L3 (NP_001001875.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 89882
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRSFEGNPKGEGSRI
Target: TPD52L3
Application Dilute: WB: WB,1:200 - 1:2000|IF/ICC,1:50 - 1:200