POLRMT Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15605T
Article Name: POLRMT Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15605T
Supplier Catalog Number: CNA15605T
Alternative Catalog Number: MBL-CNA15605T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 42-230 of human POLRMT (NP_005026.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 139kDa
NCBI: 5442
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SSASPQEQDQDRRKDWGHVELLEVLQARVRQLQAESVSEVVVNRVDVARLPECGSGDGSLQPPRKVQMGAKDATPVPCGRWAKILEKDKRTQQMRMQRLKAKLQMPFQSGEFKALTRRLQVEPRLLSKQMAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFF
Target: POLRMT
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100