ATG12 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15609P
Article Name: ATG12 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15609P
Supplier Catalog Number: CNA15609P
Alternative Catalog Number: MBL-CNA15609P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATG12 (NP_004698.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 9140
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQL
Target: ATG12
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200