TrkA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA15618S
Article Name: TrkA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA15618S
Supplier Catalog Number: CNA15618S
Alternative Catalog Number: MBL-CNA15618S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700 to the C-terminus of human TrkA (NP_002520.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 87kDa
NCBI: 4914
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
Target: NTRK1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200